Invitrogen™ Human AspRS (aa 360-442) Control Fragment Recombinant Protein

Product Code. 30201572

Brand: Invitrogen™ RP94127

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55332 (PA5-55332. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the class-II aminoacyl-tRNA synthetase family. It is a mitochondrial enzyme that specifically aminoacylates aspartyl-tRNA. Mutations in this gene are associated with leukoencephalopathy with brainstem and spinal cord involvement and lactate elevation (LBSL).

Specifications

• Accession Number: Q6PI48
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55157
• Name: Human AspRS (aa 360-442) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830468K18Rik; aspartate tRNA ligase 2, mitochondrial; aspartate--tRNA ligase, mitochondrial; Aspartyl-tRNA synthetase; aspartyl-tRNA synthetase 2 (mitochondrial); aspartyl-tRNA synthetase 2, mitochondrial; aspartyl-tRNA synthetase, mitochondrial; aspartyl-tRNA synthetase, mitochondrial; aspartate--tRNA ligase, mitochondrial; aspRS; Dars2; LBSL; MT-ASPRS; RGD1308286; si:dkey-21n10.1
• Common Name: AspRS
• Gene Symbol: DARS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining