Invitrogen™ Human Asporin (aa 165-287) Control Fragment Recombinant Protein

Product Code. 30211807

Brand: Invitrogen™ RP108145

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.

Specifications

• Accession Number: Q9BXN1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54829
• Name: Human Asporin (aa 165-287) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4631401G09Rik; AA986886; ASPN; Asporin; asporin (LRR class 1); asporin proteoglycan; FLJ20129; OS3; periodontal ligament associated protein 1; periodontal ligament-associated protein 1; PLAP1; PLAP-1; SLRR1C; small leucine-rich protein 1 C; UNQ215/PRO241
• Common Name: Asporin
• Gene Symbol: Aspn
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGLPPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLAN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining