Invitrogen™ Human ASPH (aa 506-600) Control Fragment Recombinant Protein

Product Code. 30207190

Brand: Invitrogen™ RP105009

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65929 (PA5-65929. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins. This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.

Specifications

• Accession Number: Q12797
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 444
• Name: Human ASPH (aa 506-600) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310005F16Rik; 3110001L23Rik; A beta H-J-J; AAH; AI848629; ASP beta-hydroxylase; Aspartate beta-hydroxylase; aspartate-beta-hydroxylase; aspartyl (asparaginyl) beta hydroxylase; aspartyl beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase-like; aspartyl/asparaginyl-beta-hydroxylase; ASPH; AW261690; AW561901; BAH; C79816; calsequestrin-binding protein; cardiac junctin; CASQ2BP1; cI-37; FDLAB; HAAH; humbug; JCTN; jumbug; junctate; junctin; junctional sarcoplasmic reticulum protein; peptide-aspartate beta-dioxygenase; Unknown (protein for MGC:137539)
• Common Name: ASPH
• Gene Symbol: Asph
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNGLKAQPWWTPKETGYTELVKSLERNWKLIRDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining