missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ASIC3 (aa 92-183) Control Fragment Recombinant Protein

Product Code. 30196394
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196394

Brand: Invitrogen™ RP108208

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111401 (PA5-111401. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. ACCN3 encodes a member that is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and ACCN1 has been observed as proton-gated channels sensitive to gadolinium.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UHC3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9311
Name Human ASIC3 (aa 92-183) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ACCN3; acid sensing (proton gated) ion channel 3; acid sensing ion channel 3; acid sensing ion channel subunit 3; acid-sensing (proton-gated) ion channel 3; acid-sensing ion channel 3; Amiloride-sensitive cation channel 3; amiloride-sensitive cation channel 3, testis; Asic3; AW742291; dorsal root ASIC; DRASIC; hASIC3; hTNaC1; modulatory subunit of ASIC2a; neuronal amiloride-sensitive cation channel 3; proton gated cation channel DRASIC; proton-gated cation channel subunit; SLNAC1; Testis sodium channel 1; TNaC1
Common Name ASIC3
Gene Symbol ASIC3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIFTRM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.