missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ASB13 (aa 191-267) Control Fragment Recombinant Protein

Product Code. 30211464
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211464

Brand: Invitrogen™ RP107091

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66419 (PA5-66419. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length sequences are not known.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WXK3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79754
Name Human ASB13 (aa 191-267) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2210015B19Rik; 6430573K02Rik; ankyrin repeat and SOCS box containing 13; ankyrin repeat and SOCS box protein 13; ankyrin repeat and SOCS box-containing 13; ankyrin repeat and SOCS box-containing protein 13; ankyrin repeat domain-containing SOCS box protein 13; ankyrin repeat domain-containing SOCS box protein Asb-13; ASB13; Asb-13; C85285
Common Name ASB13
Gene Symbol ASB13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.