Invitrogen™ Human ASAP1 Control Fragment Recombinant Protein

Product Code. 30206638

Brand: Invitrogen™ RP104108

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52796 (PA5-52796. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ASAP1, also known as Development and differentiation enhancing factor 1, is a protein with two ANK repeats, an Arf-GAP domain, a PH domain and a SH3 domain. ASAP1 is a homodimer known to interact with SRC and CRK and its activity is stimulated by phosphatidylinositol 4,5-biphosphate (PIP2). It possesses phosphatidylinositol 4,5-biphosphate-dependent GTPase-activating protein activity for ARF1 (ADP ribosylation factor 1) and ARF5 and a lesser activity towards ARF6. It may coordinate membrane trafficking with cell growth or actin cytoskeleton remodeling by binding to both SRC and PIP2 and may also function as a signal transduction protein involved in the differentiation of fibroblasts into adipocytes and possibly other cell types. It is widely expressed in most of the tissues. ASAP1 is a protooncogene involved in invasive breast cancer and in other types of invasive and malignant tumors, such as uveal melanomas.

Specifications

• Accession Number: Q9ULH1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 50807
• Name: Human ASAP1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein; 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein; ADP-ribosylation factor-directed GTPase-activating protein 1; AMAP1; ARF GTPase-activating protein 1; arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1; ArfGAP with SH3 domain, ankyrin repeat and PH domain 1; ArfGAP with SH3 domain, ankyrin repeat and PH domain1; Asap1; AV239055; centaurin, beta 4; CENTB4; Ddef1; DEF-1; development and differentiation enhancing factor 1; development and differentiation-enhancing factor 1; differentiation enhancing factor 1; differentiation-enhancing factor 1; Kiaa1249; mKIAA1249; PAG2; PAP; PIP2-dependent ARF1 GAP; s19; Shag1; src SH3 binding protein; ZG14P
• Common Name: ASAP1
• Gene Symbol: ASAP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STPRDKQRLSYGAFTNQIFVSTSTDSPTSPTTEAPPLPPRNAGKGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQKVALRKT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining