Invitrogen™ Human AS160 (aa 210-311) Control Fragment Recombinant Protein

Product Code. 30202234

Brand: Invitrogen™ RP102884

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AS160 (TBC1D4) is a GTPase-activiting protein for RAB2A, RAB8A, RAB10, and RAB14. The isoform 2 version of this protein promotes the insulin-induced glucose transporter SLC2A4/GLUT4 translocation at the plasma membrane. This movement increases glucose uptake. Mutations associated with the gene cause Diabetes mellitus, non-insulin-dependent, 5 (NIDDM5).

Specifications

• Accession Number: O60343
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9882
• Name: Human AS160 (aa 210-311) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5930406J04Rik; A930035N22; Akt substrate of 160 kDa; AS160; AV295684; DKFZp779C0666; Kiaa0603; NIDDM5; OTTHUMP00000040818; RGD1561609; RP11-159J2.1; RP11-159J2.3; similar to TBC1 domain family member 4; TBC (Tre-2, BUB2, CDC16) domain-containing protein; TBC Tre-2; TBC1 domain family member 4; TBC1 domain family, member 4; TBC1D4
• Common Name: AS160
• Gene Symbol: TBC1D4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTVTHKKAPSSLIDDCMEKFSLHEQQRLKIQGEQRGPDPGEDLADLEVVVPGSPGDCLPEEADGTDTHLGLPAGASQPALTSSRVCFPERILEDSGFDEQQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining