Invitrogen™ Human Arylsulfatase D (aa 445-588) Control Fragment Recombinant Protein

Product Code. 30198711

Brand: Invitrogen™ RP92109

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (27%), Rat (27%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52087 (PA5-52087. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the sulfatase family. Sulfatases are essential for the correct composition of bone and cartilage matrix. This encoded protein is postranslationally glycosylated and localized to the lysosome. Two transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: P51689
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 414
• Name: Human Arylsulfatase D (aa 445-588) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ARSD; Arylsulfatase D; ASD; testis tissue sperm-binding protein Li 39 A
• Common Name: Arylsulfatase D
• Gene Symbol: ARSD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QGAEARSAHEFLFHYCGQHLHAARWHQKDSGSVWKVHYTTPQFHPEGAGACYGRGVCPCSGEGVTHHRPPLLFDLSRDPSEARPLTPDSEPLYHAVIARVGAAVSEHRQTLSPVPQQFSMSNILWKPWLQPCCGHFPFCSCHED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining