Invitrogen™ Human ARVCF (aa 36-110) Control Fragment Recombinant Protein

Product Code. 30209476

Brand: Invitrogen™ RP106615

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65933 (PA5-65933. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in protein-protein interactions at adherens junctions.

Specifications

• Accession Number: O00192
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 421
• Name: Human ARVCF (aa 36-110) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: armadillo repeat gene deleted in velocardiofacial syndrome; armadillo repeat gene deleted in velo-cardio-facial syndrome; armadillo repeat protein deleted in velo-cardio-facial syndrome; Armadillo repeat protein deleted in velo-cardio-facial syndrome homolog; Arvcf
• Common Name: ARVCF
• Gene Symbol: ARVCF
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HVALQLERAQQPGMVSGGMGSGQPLPMAWQQLVLQEQSPGSQASLATMPEAPDVLEETVTVEEDPGTPTSHVSIV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining