Invitrogen™ Human ARTS1 (aa 644-762) Control Fragment Recombinant Protein

Product Code. 30209972

Brand: Invitrogen™ RP104752

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111151 (PA5-111151. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The endoplasmic reticulum (ER) aminopeptidase 1 (ERAP1) is a 120 kDa protein localized to the lumen of the ER, which removes NH2-terminal residues from many antigenic precursors for MHC class I peptide presentation. Peptides that are presented by MHC class I on the surface of a cell must be 8-11 residues long, and ERAP1 specifically trims peptides of 9 amino acids or more. ERAP1 is also induced by interferon- gamma. The gene encoding human ERAP1 maps to chromosome 5q15. ERAP1 has previously been characterized as adipocyte-derived leucine aminopeptidase (A-LAP), puromycin-insensitive leucine-specific aminopeptidase (PILS-AP) and aminopeptidase regulator of TNFR1 shedding (ARTS-1). A-LAP is thought to inactivate several bioactive peptides, including angiotensin II and, subsequently, may be involved in the regulation of blood pressure. PILS-AP is described as playing a role in angiogenesis by regulating the proliferation and migration of endothelial cells, and ARTS-1 is characterized as a TNFR1 binding protein that promotes TNFR1 shedding. Further research will be necessary to fully elucidate the functions of this protein.

Specifications

• Accession Number: Q9NZ08
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51752
• Name: Human ARTS1 (aa 644-762) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: adipocyte-derived leucine aminopeptidase; ALAP; A-LAP; aminopeptidase PILS; aminopeptidase regulator of TNFR1 shedding; Appils; Arts1; ARTS-1; CTD-2260A17.2; endoplasmic reticulum aminopeptidase 1; endoplasmic reticulum aminopeptidase 1 delta-Exon-11 isoform; endoplasmic reticulum aminopeptidase 1 delta-Exon-13 isoform; endoplasmic reticulum aminopeptidase 1 delta-Exon-14 isoform; endoplasmic reticulum aminopeptidase 1 delta-Exon-15 isoform; endoplasmic reticulum aminopeptidase associated with antigen processing; ERAAP; ERAAP1; ER-aminopeptidase 1; ERAP1; KIAA0525; leucyl-specific aminopeptidase PILS; PILSA; PILSAP; PILS-AP; Puromycin-insensitive leucyl-specific aminopeptidase; type 1 tumor necrosis factor receptor shedding aminopeptidase regulator; UNQ584/PRO1154; VEGF-induced aminopeptidase
• Common Name: ARTS1
• Gene Symbol: Erap1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining