missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198897

Invitrogen™ Human ARTS (aa 72-138) Control Fragment Recombinant Protein

Product Code. 30198897
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198897

Brand: Invitrogen™ RP93189

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82767 (PA5-82767. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apoptosis is related to many diseases and development. Mitochondrial proteins, such as cytochrome c, Apaf-1, and AIF play important role in apoptosis. A novel mitochondrial septin-like protein was identified recently and designated ARTS for apoptosis related protein in TGF-beta signaling pathway. ARTS that is encoded by the human septin H5/PNUTL2/CDCrel2b gene is located to mitochondria and translocates to the nucleus when apoptosis occurs. ARTS is expressed in many tissues. It enhances cell death induced by TGF-beta and, to a lesser extent, by other apoptotic agents, such as TNF-a and Fas ligand.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43236
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5414
Name Human ARTS (aa 72-138) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4-Sep; apoptosis-related protein in the TGF-beta signaling pathway; ARTS; Bh5; BRADEION; Bradeion beta; brain protein H5; C17orf47; CE5B3; CE5B3 beta; cell division control-related protein 2; cell division control-related protein 2 b; cerebral protein 7; EG3-1 RVC; EG3RVC; expression gene 3 in. rat visual cortex; expression gene 3-1 in. rat visual cortex; H5; hCDCREL-2; hucep-7; MART; M-Septin; OTTMUSG00000001265; peanut-like 2; peanut-like 2 homolog; peanut-like protein 2; PNUTL2; SEP4; Sept4; septin 4; septin H5; Septin4; septin-4; septin-M; Uncharacterized protein C17orf47
Common Name ARTS
Gene Symbol SEPTIN4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.