Invitrogen™ Human ARSJ (aa 499-561) Control Fragment Recombinant Protein

Product Code. 30205470

Brand: Invitrogen™ RP104163

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57678 (PA5-57678. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ARSJ is a sulfatase that hydrolyzes sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. Sulfatases are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.

Specifications

• Accession Number: Q5FYB0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79642
• Name: Human ARSJ (aa 499-561) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9330196J05Rik; Arsj; arylsulfatase family member J; arylsulfatase family, member J; arylsulfatase J; ASJ; D830047F08; RGD1307640; UNQ372/PRO708
• Common Name: ARSJ
• Gene Symbol: ARSJ
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining