Invitrogen™ Human ARS2 (aa 420-516) Control Fragment Recombinant Protein

Product Code. 30198081

Brand: Invitrogen™ RP92626

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60148 (PA5-60148. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as a mediator between the cap-binding complex (CBC) and the primary microRNAs (miRNAs) processing machinery during cell proliferation. Contributes to the stability and delivery of capped primary miRNA transcripts to the primary miRNA processing complex containing DGCR8 and DROSHA, thereby playing a role in RNA-mediated gene silencing (RNAi) by miRNAs. Binds capped RNAs (m7GpppG-capped RNA); however interaction is probably mediated via its interaction with NCBP1/CBP80 component of the CBC complex. Involved in cell cycle progression at S phase. Does not directly confer arsenite resistance but rather modulates arsenic sensitivity. Independently of its activity on miRNAs, necessary and sufficient to promote neural stem cell self-renewal. Does so by directly binding SOX2 promoter and positively regulating its transcription. [UniProt]

Specifications

• Accession Number: Q9BXP5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51593
• Name: Human ARS2 (aa 420-516) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810019G02Rik; Ars2; arsenate resistance protein 2; arsenate resistance protein ARS2; arsenite resistance protein; arsenite resistance protein 2; arsenite-resistance protein 2; Asr2; ASR2A; ASR2B; ASR2C; ASR2D; ch211-283g2.4; CHUNP6881; LOC686980; serrate; Serrate RNA effector molecule homolog; serrate RNA effector molecule homolog (Arabidopsis); serrate, RNA effector molecule; similar to arsenate resistance protein 2; srrt; zgc:92060
• Common Name: ARS2
• Gene Symbol: SRRT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining