Invitrogen™ Human ARPIN (aa 74-148) Control Fragment Recombinant Protein

Product Code. 30197844

Brand: Invitrogen™ RP104425

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61457 (PA5-61457. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ARPIN gene ontology annotations related to this gene include negative regulation of actin nucleation.

Specifications

• Accession Number: Q7Z6K5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 348110
• Name: Human ARPIN (aa 74-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610034B18Rik; actin related protein 2/3 complex inhibitor; actin-related protein 2/3 complex inhibitor; arp2/3 inhibition protein; Arpin; C15orf38; C21H15orf38; C3H15orf38; C7H15orf38; hypothetical protein LOC550477; RGD1311021; RIKEN cDNA 2610034B18 gene; si:ch211-200o3.3; UPF0552 protein C15orf38; UPF0552 protein C15orf38 homolog; zgc:112432
• Common Name: ARPIN
• Gene Symbol: ARPIN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEME
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining