Invitrogen™ Human ARPC2 (aa 38-146) Control Fragment Recombinant Protein

Product Code. 30202208

Brand: Invitrogen™ RP108896

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.

Specifications

• Accession Number: O15144
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10109
• Name: Human ARPC2 (aa 38-146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210023N03Rik; 34 kDa; actin related protein 2/3 complex subunit 2; actin related protein 2/3 complex subunit 2, 34 kDa; actin related protein 2/3 complex, subunit 2; actin related protein 2/3 complex, subunit 2, 34 kDa; actin-related protein 2/3 complex subunit 2; actin-related protein 2/3 complex subunit 2 {ECO:0000250; ARC34; Arp2/3 complex 34 kDa subunit; arp2/3 complex 34 kDa subunit {ECO:0000250; ARP2/3 protein complex subunit 34; ARPC2; arpc2 {ECO:0000250; p34-ARC; p34-ARC {ECO:0000250; PNAS-139; PRO2446; testis tissue sperm-binding protein Li 53 e; UniProtKB:O15144}
• Common Name: ARPC2
• Gene Symbol: ARPC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining