Invitrogen™ Human AROS (aa 68-136) Control Fragment Recombinant Protein

Product Code. 30198990

Brand: Invitrogen™ RP92363

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60153 (PA5-60153. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AROS, a nucleolar protein with an unknown function, interacts with extra ribosomal protein RPS19, playing a role in the signaling pathways that regulate rRNA transcription. The deduced amino acid sequence of AROS, derived from cDNA, defines an isoelectric point of 11.3. No known functional motifs were found in AROS except a short polylysine tract embedded in a putative nucleolar localization signal. At a basal level the protein is expressed ubiquitously with a significantly high level of expression in some tissues. Human AROS gene is mapped to chromosome 22q13.1.

Specifications

• Accession Number: Q86WX3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91582
• Name: Human AROS (aa 68-136) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2510038A11Rik; 40 S ribosomal protein S19-binding protein 1; Active regulator of SIRT1; AI604923; AROS; dJ1104E15.4; homolog of mouse S19 binding protein; RGD1562823; ribosomal protein S19 binding protein 1; RP5-1104E15.4; RPS19-binding protein 1; RPS19BP1; S19 binding protein; S19BP
• Common Name: AROS
• Gene Symbol: RPS19BP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining