missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ARMX3 (aa 38-152) Control Fragment Recombinant Protein

Product Code. 30196656
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196656

Brand: Invitrogen™ RP91936

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51376 (PA5-51376. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UH62
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51566
Name Human ARMX3 (aa 38-152) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200004E24Rik; AI450003; ALEX3; ARM protein lost in epithelial cancers on chromosome x 3; arm protein lost in epithelial cancers, x chromosome, 3; armadillo repeat containing X-linked 3; armadillo repeat containing, X-linked 3; armadillo repeat-containing X-linked protein 3; armadillo repeat-containing X-linked protein 3-like protein; Armcx3; BM-017; dJ545K15.2; DKFZp781N1954; GASP6; KIAA0443; MGC12199; Protein ALEX3; UNQ2517/PRO6007
Common Name ARMX3
Gene Symbol ARMCX3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.