Invitrogen™ Human ARMX2 (aa 31-175) Control Fragment Recombinant Protein

Product Code. 30209314

Brand: Invitrogen™ RP92150

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52201 (PA5-52201. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The armadillo (ARM) repeat family of proteins are related to the Drosophila melanogaster armadillo protein, a protein essential for wingless signal transduction. ARM proteins are involved in a variety of processes such as cell migration, cell proliferation, tissue maintenance and tumorigenesis, and they also function in signal transduction and the maintenance of overall cell structure. ARMCX2 (armadillo repeat containing, X-linked 2), also known as ALEX2, is a 632 amino acid single-pass membrane protein that contains three ARM repeats and is highly expressed in testis, brain, ovary, heart, colon, spleen and prostate, where it is thought to play a role in tumor suppression. The gene encoding ARMCX2 maps to human chromosome X, which contains nearly 153 million base pairs and houses over 1, 000 genes.

Specifications

• Accession Number: Q7L311
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9823
• Name: Human ARMX2 (aa 31-175) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3230401N03Rik; AI043003; ALEX2; ALEX2 protein; ARM protein lost in epithelial cancers on chromosome x 2; armadillo repeat containing, X-linked 2; armadillo repeat protein ALEX2; armadillo repeat-containing X-linked protein 2; ARMCX2; GASP9; Kiaa0512; Protein ALEX2
• Common Name: ARMX2
• Gene Symbol: ARMCX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RDQTKKRMAKPKNRAVAGTGARARAGLRAGFTIDLGSGFSPPTPVRAEAEDRAQDEASALDTVGAEAVAPAASSAEAQSGAGSQAQEADGAGVGPKAESVVGAAMASAIAPPPGVTEALGAAEAPAMAGAPKVAEAPREAETSRA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining