missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ARMX2 (aa 31-175) Control Fragment Recombinant Protein

Product Code. 30209314
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30209314

missing translation for 'mfr': Invitrogen™ RP92150

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52201 (PA5-52201. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The armadillo (ARM) repeat family of proteins are related to the Drosophila melanogaster armadillo protein, a protein essential for wingless signal transduction. ARM proteins are involved in a variety of processes such as cell migration, cell proliferation, tissue maintenance and tumorigenesis, and they also function in signal transduction and the maintenance of overall cell structure. ARMCX2 (armadillo repeat containing, X-linked 2), also known as ALEX2, is a 632 amino acid single-pass membrane protein that contains three ARM repeats and is highly expressed in testis, brain, ovary, heart, colon, spleen and prostate, where it is thought to play a role in tumor suppression. The gene encoding ARMCX2 maps to human chromosome X, which contains nearly 153 million base pairs and houses over 1, 000 genes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7L311
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9823
Name Human ARMX2 (aa 31-175) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3230401N03Rik; AI043003; ALEX2; ALEX2 protein; ARM protein lost in epithelial cancers on chromosome x 2; armadillo repeat containing, X-linked 2; armadillo repeat protein ALEX2; armadillo repeat-containing X-linked protein 2; ARMCX2; GASP9; Kiaa0512; Protein ALEX2
Common Name ARMX2
Gene Symbol ARMCX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RDQTKKRMAKPKNRAVAGTGARARAGLRAGFTIDLGSGFSPPTPVRAEAEDRAQDEASALDTVGAEAVAPAASSAEAQSGAGSQAQEADGAGVGPKAESVVGAAMASAIAPPPGVTEALGAAEAPAMAGAPKVAEAPREAETSRA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.