Invitrogen™ Human ARMER (aa 92-132) Control Fragment Recombinant Protein

Product Code. 30203246

Brand: Invitrogen™ RP91178

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60977 (PA5-60977. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apoptosis is important for normal development and tissue homeostasis. It is mediated by various caspases and ultimately results in the activation of endogenous endonucleases that degrade cellular DNA. Although apoptosis induced by endoplasmic reticulum (ER) stress is thought to be mediated by caspase-12, other caspases such as caspase-9 are also thought to be activated following ER stress. Recently, ARMER, a novel integral ER-membrane protein was shown to protect cells from ER stress-induced apoptosis. Analysis of the caspase proteolytic cascade suggests that ARMER acts by inhibiting caspase-9 activity, although the mechanism for this remains unknown. It should be noted that ARMER is not related to the inhibitor of apoptosis proteins (IAP) family and does not contain any baculoviral IAP repeat (BIR) domains.

Specifications

• Accession Number: Q15041
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23204
• Name: Human ARMER (aa 92-132) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ADP ribosylation factor like GTPase 6 interacting protein 1; ADP-ribosylation factor GTPase 6 interacting protein 1; ADP-ribosylation factor like GTPase 6 interacting protein 1; ADP-ribosylation factor-like 6 interacting protein; ADP-ribosylation factor-like 6 interacting protein 1; ADP-ribosylation factor-like protein 6-interacting protein 1; ADP-ribosylation factor-like protein 6-interacting protein 1-like protein; ADP-ribosylation-like factor 6 interacting protein; ADP-ribosylation-like factor 6-interacting protein; AIP1; aip-1; AIP-6; AL022945; apoptotic regulator in the membrane of the endoplasmic reticulum; ARL-6-interacting protein 1; Arl6ip; arl6ip protein; Arl6ip1; ARMER; AU042858; C85138; KIAA0069; mKIAA0069; Protein TB x 2; SPG61; zgc:56593; zgc:77873
• Common Name: ARMER
• Gene Symbol: ARL6IP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining