Invitrogen™ Human ARL6IP4 (aa 104-204) Control Fragment Recombinant Protein

Code produit. 30180590

Marque: Invitrogen™ RP97873

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62548 (PA5-62548. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ARL6IP4 is a protein coding gene involved in modulating alternative pre-mRNA splicing with either 5' distal site activation or preferential use of 3' proximal site. In case of infection by Herpes simplex virus (HSVI), may act as a splicing inhibitor of HSVI pre-mRNA.

Spécification

• Accession Number: Q66PJ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51329
• Name: Human ARL6IP4 (aa 104-204) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA408210; AA408365; ADP ribosylation factor like GTPase 6 interacting protein 4; ADP-ribosylation factor GTPase 6 interacting protein 4; ADP-ribosylation factor like GTPase 6 interacting protein 4; ADP-ribosylation factor-like 6 interacting protein 4; ADP-ribosylation factor-like protein 6-interacting protein 4; ADP-ribosylation-like factor 6 interacting protein 4; aip-4; ARL-6-interacting protein 4; Arl6ip4; HSP-975; HSVI binding protein; HSVI-binding protein; SFRS20; Splicing factor SRrp37; splicing factor, arginine/serine-rich 20; splicing regulator SRrp38; SR-15; SR-25; SRp25; SRp25 nuclear protein; SRrp37
• Common Name: ARL6IP4
• Gene Symbol: ARL6IP4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KKGKEKAEAQQVEALPGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKVGVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining