missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204738

Invitrogen™ Human ARL4D (aa 1-35) Control Fragment Recombinant Protein

Product Code. 30204738
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204738

Brand: Invitrogen™ RP101956

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63851 (PA5-63851. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49703
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 379
Name Human ARL4D (aa 1-35) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110036H21Rik; ADP ribosylation factor like GTPase 4 D; ADP-ribosylation factor like GTPase 4 D; ADP-ribosylation factor-like 4 D; ADP-ribosylation factor-like 5; ADP-ribosylation factor-like 6; ADP-ribosylation factor-like protein 4 D; ADP-ribosylation factor-like protein 4 L; ADP-ribosylation factor-like protein 5; Arf4l; Arfl4; ARL4D; Arl5; ARL6; AW456149; neuroprotective protein 2
Common Name ARL4D
Gene Symbol ARL4D
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.