Invitrogen™ Human ARL3 (aa 124-162) Control Fragment Recombinant Protein

Product Code. 30197281

Brand: Invitrogen™ RP107258

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111568 (PA5-111568. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADP-ribosylation factors (ARFs) are low molecular weight GTP-binding proteins belonging to the RAS superfamily. The predicted 182-amino acid ARL3 (ADP-ribosylation like factor) protein shares 97% amino acid identity with rat ARLl3 and 43% identity with human ARF1. Like the ARFs, ARL3 has a glycine at position 2, the site of N myristoylation, and lacks cysteine residues near the C terminus, which are found in other members of the RAS family. Northern blot analysis detected a 1-kb ARL3 transcript in all tissues tested, with highest expression in heart and lung, and lower expression in brain, liver, kidney, ovary, and testis. A 5.5-kb transcript was also detected in most tissues, with highest expression in brain. Immunoblot analysis detected ARL3 in human tumor cell lines but not in normal rodent cells. Although ARL3 binds GTP, it is devoid of activity in the cholera toxin-dependent ADP-ribosylation of Gs, and is therefore classified as an ARF-like protein.

Specifications

• Accession Number: P36405
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 403
• Name: Human ARL3 (aa 124-162) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ADP ribosylation factor like GTPase 3; ADP-ribosylation factor like GTPase 3; ADP-ribosylation factor-like 3; ADP-ribosylation factor-like protein 3; ADP-ribosylation-like 3; ARD3; ARFL3; ARF-like 3; Arf-like protein 3; Arl3
• Common Name: ARL3
• Gene Symbol: Arl3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining