Invitrogen™ Human ARIH2 (aa 31-118) Control Fragment Recombinant Protein

Product Code. 30210957

Brand: Invitrogen™ RP107707

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

E3 ubiquitin-protein ligase mediating 'Lys-48'-and 'Lys-63'-linked polyubiquitination and subsequent proteasomal degradation of modified proteins. May play a role in myelopoiesis.

Specifications

• Accession Number: O95376
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10425
• Name: Human ARIH2 (aa 31-118) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI843547; all-trans retinoic acid inducible RING finger; ARI2; ARI-2; ariadne 2; ariadne homolog 2; ariadne homolog 2 (Drosophila); ariadne RBR E3 ubiquitin protein ligase 2; ARIH2; E3 ubiquitin-protein ligase ARIH2; FLJ10938; FLJ33921; HT005; OTTHUMP00000210388; protein ariadne-2 homolog; Protein ariadne-2-like protein-like protein; RING-type E3 ubiquitin transferase ARIH2; Triad1; Triad1 protein; UbcM4-interacting protein 48; Uip48
• Common Name: ARIH2
• Gene Symbol: Arih2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining