missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ARID1B (aa 915-1030) Control Fragment Recombinant Protein

Product Code. 30208299
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208299

Brand: Invitrogen™ RP91593

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53438 (PA5-53438. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This locus encodes an AT-rich DNA interacting domain-containing protein. The encoded protein is a component of the SWI/SNF chromatin remodeling complex and may play a role in cell-cycle activation. The protein encoded by this locus is similar to AT-rich interactive domain-containing protein 1A. These two proteins function as alternative, mutually exclusive ARID-subunits of the SWI/SNF complex. The associated complexes play opposing roles. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Feb 2012].
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NFD5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57492
Name Human ARID1B (aa 915-1030) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6A3-5; 8030481M12; 9330189K18Rik; AI836955; Ardi1b; ARID domain-containing protein 1 B; ARID1B; AT rich interactive domain 1 B (Swi1 like); AT rich interactive domain 1 B (SWI1-like); AT rich interactive domain 1 B (SWI-like); AT-rich interaction domain 1 B; AT-rich interactive domain-containing protein 1 B; B230217J03Rik; BAF250B; BRG1-associated factor 250 b; BRG1-binding protein ELD/OSA1; BRG1-binding protein hELD/OSA1; BRIGHT; CSS1; DAN15; ELD (eyelid)/OSA protein; ELD/OSA1; hOsa2; KIAA1235; mKIAA1235; MRD12; Osa homolog 2; OSA2; P250R; Smcf1; smcf-1; transcription factor 1
Common Name ARID1B
Gene Symbol ARID1B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNMSSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.