Invitrogen™ Human ARID1A (aa 1266-1370) Control Fragment Recombinant Protein

Product Code. 30209710

Brand: Invitrogen™ RP89207

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52146 (PA5-52146. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: O14497
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8289
• Name: Human ARID1A (aa 1266-1370) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110030E03Rik; ARID domain-containing protein 1 A; ARID1A; AT rich interactive domain 1 A (Swi1 like); AT rich interactive domain 1 A (SWI-like); AT-rich interaction domain 1 A; AT-rich interactive domain-containing protein 1 A; B120; BAF250; Baf250a; BM029; brain protein 120; BRG1-associated factor 250; BRG1-associated factor 250 A; C1orf4; chromatin remodeling factor p250; CSS2; ELD; h BM029; hELD; hOSA1; MRD14; Osa homolog 1; Osa1; OSA1 nuclear protein; P270; Smarcf1; SWI/SNF complex protein p270; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1; SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1; Swi1 like; SWI-like protein; SWI-SNF complex protein p270
• Common Name: ARID1A
• Gene Symbol: ARID1A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining