missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ARHGEF7 (aa 516-650) Control Fragment Recombinant Protein

Product Code. 30195303
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195303

Brand: Invitrogen™ RP88620

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52097 (PA5-52097. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The serine/threonine kinase, p21 activated kinase (PAK), is a downstream effector of the small GTPases Cdc42 and Rac. PAK associates with Nck, the p85 and p110 subunits of PI3-kinase and PIX (PAK-interacting exchange factor) in a focal complex. The binding of PIX is necessary for the localization and activation of PAK in the Cdc42 to Rac signaling pathway, and this binding occurs through the high affinity of the N-terminal SH3 domain of PIX for a conserved proline rich PAK sequence. PIX exists as two isoforms, alpha and beta, and both are highly expressed in heart, muscle and thymus tissues of human and rat. alphaPIX is phosphorylated via PDGF and EphB2 receptor signaling pathways or through association with PI3-kinase. The alphaPIX isoform predominantly acts as a guanine nucleotide exchange factor (GEF) on Rac, which may mediate lamellipodia formation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14155
Concentration 3.20 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8874
Name Human ARHGEF7 (aa 516-650) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ARHGEF7; betaPix; Beta-Pix; betaPix-b; betaPix-c; Cool; COOL1; cool-1; KIAA0142; mKIAA0142; Nbla10314; P50; P50BP; p85; p85Cool1; p85SPR; PAK3; Pak3 binding protein; Pak3bp; PAK-interacting exchange factor beta; PIX; Pixb; PIXbeta; Rho guanine nucleotide exchange factor (GEF) 7; Rho guanine nucleotide exchange factor (GEF7); Rho guanine nucleotide exchange factor 7; SH3 domain-containing proline-rich protein
Common Name ARHGEF7
Gene Symbol Arhgef7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.