Invitrogen™ Human ARHGEF7 (aa 516-650) Control Fragment Recombinant Protein

Product Code. 30195303

Brand: Invitrogen™ RP88620

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52097 (PA5-52097. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The serine/threonine kinase, p21 activated kinase (PAK), is a downstream effector of the small GTPases Cdc42 and Rac. PAK associates with Nck, the p85 and p110 subunits of PI3-kinase and PIX (PAK-interacting exchange factor) in a focal complex. The binding of PIX is necessary for the localization and activation of PAK in the Cdc42 to Rac signaling pathway, and this binding occurs through the high affinity of the N-terminal SH3 domain of PIX for a conserved proline rich PAK sequence. PIX exists as two isoforms, alpha and beta, and both are highly expressed in heart, muscle and thymus tissues of human and rat. alphaPIX is phosphorylated via PDGF and EphB2 receptor signaling pathways or through association with PI3-kinase. The alphaPIX isoform predominantly acts as a guanine nucleotide exchange factor (GEF) on Rac, which may mediate lamellipodia formation.

Specifications

• Accession Number: Q14155
• Concentration: 3.20 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8874
• Name: Human ARHGEF7 (aa 516-650) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ARHGEF7; betaPix; Beta-Pix; betaPix-b; betaPix-c; Cool; COOL1; cool-1; KIAA0142; mKIAA0142; Nbla10314; P50; P50BP; p85; p85Cool1; p85SPR; PAK3; Pak3 binding protein; Pak3bp; PAK-interacting exchange factor beta; PIX; Pixb; PIXbeta; Rho guanine nucleotide exchange factor (GEF) 7; Rho guanine nucleotide exchange factor (GEF7); Rho guanine nucleotide exchange factor 7; SH3 domain-containing proline-rich protein
• Common Name: ARHGEF7
• Gene Symbol: Arhgef7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining