Invitrogen™ Human ARHGEF3 (aa 427-497) Control Fragment Recombinant Protein

Product Code. 30196336

Brand: Invitrogen™ RP96425

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57027 (PA5-57027. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Rho-like GTPases are involved in a variety of cellular processes, and they are activated by binding GTP and inactivated by conversion of GTP to GDP by their intrinsic GTPase activity. Guanine nucleotide exchange factors (GEFs) accelerate the GTPase activity of Rho GTPases by catalyzing their release of bound GDP. This gene encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in this gene plays a role in the determination of bone mineral density (BMD), indicating the implication of this gene in postmenopausal osteoporosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9NR81
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 50650
• Name: Human ARHGEF3 (aa 427-497) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200004I24Rik; 59.8 kDA protein; 9830169H03Rik; ARHG3; ARHGEF3; C76747; DKFZP434F2429; Exchange factor found in platelets and leukemic and neuronal tissues; exchange factor found in platelets and leukemic and neuronal tissues, XPLN; GEF3; MGC118905; Rho guanine nucleotide exchange factor (GEF) 3; Rho guanine nucleotide exchange factor 3; RhoGEF protein; STA3; Xpln
• Common Name: ARHGEF3
• Gene Symbol: ARHGEF3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGETKLEQMDQSDSESDCSM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining