Invitrogen™ Human ARHGEF1 (aa 225-338) Control Fragment Recombinant Protein

Product Code. 30200661

Brand: Invitrogen™ RP90633

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Ras superfamily of GTPases, which can be subdivided into the Ras, Rho/Rac, Sar, Rab, ARF and Ran subfamilies, controls multiple aspects of cell function, including cytoskeletal rearrangement, nuclear signaling and cell growth. The Ras superfamily of GTPases function as regulated switches that toggle between a biologically active GTP-bound and an inactive GDP-bound form. This activation is catalyzed by guanine nucleotide exchange factors (GEFs). The Dbl-related proteins are a large family of structurally related molecules that have a common ability to catalyze GEF activity for specific members of the Ras family. Dbl-related proteins include FGD1, Lsc, RhoGEF p115, Lfc, Lbc and Brx. Lsc, Lbc and Lfc share sequence homology and show exchange activity toward Rho family GTPases. RhoGEF p115 catalyzes GEF activity for Rho but not Rac, Cdc42 or Ras GTPases.

Specifications

• Accession Number: Q92888
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9138
• Name: Human ARHGEF1 (aa 225-338) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 115 kDa guanine nucleotide exchange factor; 115-kD protein; ARHGEF1; GEF1; LBCL2; Lbc's second cousin; Lsc; Lsc homolog; lymphoid blast crisis like 2; lymphoid blast crisis-like 2; p115RhoGEF; p115-RhoGEF; Rho guanine nucleotide exchange factor (GEF) 1; Rho guanine nucleotide exchange factor 1; Sub1.5
• Common Name: ARHGEF1
• Gene Symbol: Arhgef1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining