Invitrogen™ Human ARHGAP32 (aa 1076-1170) Control Fragment Recombinant Protein

Product Code. 30209776

Brand: Invitrogen™ RP102828

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58365 (PA5-58365. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GTPase-activating protein (GAP) promoting GTP hydrolysis on RHOA, CDC42 and RAC1 small GTPases. May be involved in the differentiation of neuronal cells during the formation of neurite extensions. Involved in NMDA receptor activity-dependent actin reorganization in dendritic spines. May mediate cross-talks between Ras- and Rho regulated signaling pathways in cell growth regulation. Isoform 2 has higher GAP activity.

Specifications

• Accession Number: A7KAX9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9743
• Name: Human ARHGAP32 (aa 1076-1170) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3426406O18Rik; 6430596G11Rik; AI841135; ARHGAP32; Arhgap35; brain-specific Rho GTP-ase-activating protein; brain-specific Rho GTPase-activating protein; BRF2; butyrate response factor 2; EGF-response factor 2; ERF2; ERF-2; GAB-associated CDC42; GAB-associated Cdc42/Rac GTPase-activating protein; GAP-associated protein p190; Gc-gap; glucocorticoid receptor DNA binding factor 1; glucocorticoid receptor DNA-binding factor 1; Glucocorticoid receptor repression factor 1; GRF1; GRF-1; Grit; Grlf1; GTPase regulator interacting with TrkA; GTPase-activating protein for Cdc42 and Rac1; KIAA0712; KIAA1722; mKIAA0712; mKIAA1722; mRNA decay activator protein ZFP36L2; P190 RhoGAP; p190A; p190-A; p190ARHOGAP; p190RhoGAP; p200RhoGAP; p250Gap; PX-RICS; rac GTPase activating protein; rho GAP p190A; Rho GTPase activating protein 32; Rho GTPase activating protein 33 pseudogene; Rho GTPase activating protein 35; rho GTPase-activating protein 32; Rho GTPase-activating protein 35; Rho/Cdc42/Rac GTPase-activating protein RICS; rhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling; RhoGAP involved in the -catenin-N-cadherin and NMDA receptor signaling; rho-type GTPase-activating protein 32; RICS; RNF162C; TIS11D; TPA-induced sequence 11 d; ZFP36 ring finger protein like 2; ZFP36 ring finger protein-like 2; Zfp36l2; ZFP36-like 2; zinc finger protein 36, C3H type-like 1; zinc finger protein 36, C3H type-like 2; zinc finger protein 36, C3H type-like 2-like; zinc finger protein 36, C3H1 type-like 2; zinc finger protein, C3H type, 36-like 2
• Common Name: ARHGAP32
• Gene Symbol: ARHGAP32
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AVATTEDNLSSSYSAVALDKAYFQTDRPAEQFHLQNNAPGNCDHPLPETTATGDPTHSNTTESGEQHHQVDLTGNQPHQAYLSGDPEKARITSVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining