Invitrogen™ Human ARHGAP20 (aa 837-920) Control Fragment Recombinant Protein

Product Code. 30194145

Brand: Invitrogen™ RP97366

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58398 (PA5-58398. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ARHGAP20 is a potent GTPase-activating protein (GAP) and convert Rho-type GTPases into an inactive GDP-bound state. It contains a pleckstrin homology (PH) domain, a Ras-associating domain, a Rho-GAP domain and two Annexin-like (ANXL) repeats. ARHGAP20 is a direct downstream target of Rap1 in the neurite outgrowth while it's over expression leads to inactivation of Rho for promoting the neurite outgrowth in a Rap1-dependent manner. ARHGAP20 is a tumor suppressor gene and is inactivated by deletion in breast cancer and also by chromosomal translocation in B-cell chronic lymphocytic leukemia. Reports suggest that it may take part in rearrangements of the cytoskeleton and cell signaling events that occur during spermatogenesis. It is expressed predominantly in human brain, liver, ovary and spinal cord while low expression is found in lymph nodes and fetal liver.

Specifications

• Accession Number: Q9P2F6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57569
• Name: Human ARHGAP20 (aa 837-920) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6530403F17Rik; A530023E23Rik; Arhgap20; KIAA1391; mKIAA1391; RA and RhoGAP domain containing protein; RA and RhoGAP domain-containing protein; RARhoGAP; Rho GTPase activating protein 20; rho GTPase activating protein 20 variant 2; rho GTPase-activating protein 20; RhoGTPase activating protein; Rho-type GTPase-activating protein 20
• Common Name: ARHGAP20
• Gene Symbol: ARHGAP20
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGPRTHRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGLLHGEEDYLKRHKSLQMEGQKLINQSLVMGIEVGKSSATNQNTE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining