missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ARHGAP20 (aa 284-368) Control Fragment Recombinant Protein

Product Code. 30199641
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199641

Brand: Invitrogen™ RP108080

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111737 (PA5-111737. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ARHGAP20 is a potent GTPase-activating protein (GAP) and convert Rho-type GTPases into an inactive GDP-bound state. It contains a pleckstrin homology (PH) domain, a Ras-associating domain, a Rho-GAP domain and two Annexin-like (ANXL) repeats. ARHGAP20 is a direct downstream target of Rap1 in the neurite outgrowth while it's over expression leads to inactivation of Rho for promoting the neurite outgrowth in a Rap1-dependent manner. ARHGAP20 is a tumor suppressor gene and is inactivated by deletion in breast cancer and also by chromosomal translocation in B-cell chronic lymphocytic leukemia. Reports suggest that it may take part in rearrangements of the cytoskeleton and cell signaling events that occur during spermatogenesis. It is expressed predominantly in human brain, liver, ovary and spinal cord while low expression is found in lymph nodes and fetal liver.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9P2F6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57569
Name Human ARHGAP20 (aa 284-368) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6530403F17Rik; A530023E23Rik; Arhgap20; KIAA1391; mKIAA1391; RA and RhoGAP domain containing protein; RA and RhoGAP domain-containing protein; RARhoGAP; Rho GTPase activating protein 20; rho GTPase activating protein 20 variant 2; rho GTPase-activating protein 20; RhoGTPase activating protein; Rho-type GTPase-activating protein 20
Common Name ARHGAP20
Gene Symbol ARHGAP20
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence STTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPGQLFGISLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.