Invitrogen™ Human ARHGAP12 (aa 286-452) Control Fragment Recombinant Protein

Product Code. 30210780

Brand: Invitrogen™ RP93706

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51384 (PA5-51384. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Specifications

• Accession Number: Q8IWW6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 94134
• Name: Human ARHGAP12 (aa 286-452) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810011M08Rik; ARHGAP12; FLJ10971; FLJ20737; FLJ21785; Rho GTPase activating protein 12; rho GTPase-activating protein 12; Rho-type GTPase-activating protein 12
• Common Name: ARHGAP12
• Gene Symbol: ARHGAP12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGTQERTWKPPRWTRDASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining