Invitrogen™ Human Arginase 1 (aa 178-301) Control Fragment Recombinant Protein

Product Code. 30181919

Brand: Invitrogen™ RP99365

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82861 (PA5-82861. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Arginase-1 (Arg1) is a 35 kDa enzyme converting L-arginine to urea and L-ornithine, which is the final step in the urea cycle. The resulting polyamines are important for cell proliferation and removal of toxins that arise from protein degradation. By degrading arginine, Arginase 1 deprives NO synthase of its substrate and down-regulates nitric oxide production. In both human and mouse, Arginase 1 is expressed in the liver, neutrophils, myeloid derived suppressor cells (MDSC) and neural stem cells. In human, expression in blood neutrophils but not in CCR3+ granulocytes has been reported. In mice, expression of Arginase 1 is one of the hallmarks of alternatively activated macrophages (M2a). Arginase-1 may be expressed in the myeloid cells infiltrating tumors, and is typically found in the majority of hepatocellular carcinomas. Defects in Arginase 1 are the cause of argininemia, an autosomal recessive disorder characterized by hyperammonemia.

Specifications

• Accession Number: P05089
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 383
• Name: Human Arginase 1 (aa 178-301) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI; A-I; AI type I arginase; AI256583; Arg1; Arg-1; Arginase; arginase 1; arginase 1 liver; arginase 1, liver; arginase I; arginase, liver; Arginase1; arginase-1; HGNC:663; Liver Arginase; Liver-type arginase; PGIF; similar to arginase, type I; Type 1 Arginase; type I arginase
• Common Name: Arginase 1
• Gene Symbol: ARG1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining