Invitrogen™ Human ARFGAP1 (aa 141-243) Control Fragment Recombinant Protein

Product Code. 30206792

Brand: Invitrogen™ RP103251

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84282 (PA5-84282. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ArfGAP1 is a 406 amino acid containing regulatory protein with an Arf-GAP domain known to be involved in the activation of the GTPase activity of ADP ribosylation factor (ARF). ArfGAP1, a GTPase-activating protein (GAP) for the ADP ribosylation factor 1 (ARF1), promotes the hydrolysis of ARF1-bound GTP and is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles thus playing an important role in membrane trafficking and/or vesicle transport. Dissociation of the coat proteins is required for the fusion of these vesicles with target compartments. The activity of this protein is stimulated by phosphoinosides and inhibited by phosphatidylcholine. Two transcript variants encoding different isoforms have been reported. Ubiquitous expression of ArfGAP1 is seen in most tissues.

Specifications

• Accession Number: Q8N6T3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55738
• Name: Human ARFGAP1 (aa 141-243) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ADP ribosylation factor GTPase activating protein 1; ADP-ribosylation factor 1 GTPase activating protein; ADP-ribosylation factor 1 GTPase-activating protein; ADP-ribosylation factor GTPase activating protein 1; ADP-ribosylation factor GTPase-activating protein 1; AI115377; ARF GAP 1; Arf GAP1; ARF1 GAP; ARF1-directed GTPase-activating protein; Arf1gap; ARFGAP1; EGK_02194; GAP protein; HRIHFB2281; RP11-261N11.1
• Common Name: ARFGAP1
• Gene Symbol: ARFGAP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTPPPQKKEDDFLNNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQKASEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining