Invitrogen™ Human Arfaptin 1 (aa 1-43) Control Fragment Recombinant Protein

Product Code. 30205091

Brand: Invitrogen™ RP103525

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64132 (PA5-64132. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ARFIP1 gene ontology annotations related to this gene include regulation of protein secretion.

Specifications

• Accession Number: P53367
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27236
• Name: Human Arfaptin 1 (aa 1-43) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310030I10Rik; ADP ribosylation factor interacting protein 1; ADP-ribosylation factor interacting protein 1; ADP-ribosylation factor-interacting protein 1; Arfaptin; arfaptin 1; Arfaptin1; arfaptin-1; Arfip1; ARFP1; D3Ertd598e; HSU52521
• Common Name: Arfaptin 1
• Gene Symbol: ARFIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining