Invitrogen™ Human Aquaporin 8 (aa 4-34) Control Fragment Recombinant Protein

Product Code. 30181553

Brand: Invitrogen™ RP98366

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61197 (PA5-61197. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aquaporin-8 is a protein that in humans is encoded by the AQP8 gene. Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 8 mRNA is found in pancreas and colon but not other tissues. Forms a water-specific channel; mercury-sensitive. Not permeable to glycerol or urea. Expressed only in pancreas and colon.

Specifications

• Accession Number: O94778
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 343
• Name: Human Aquaporin 8 (aa 4-34) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI255744; AQP8; AQP-8; aquaporin 8; Aquaporin8; aquaporin-8; membrane water channel; MGC93492; water channel
• Common Name: Aquaporin 8
• Gene Symbol: Aqp8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EIAMCEPEFGNDKAREPSVGGRWRVSWYERF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining