Invitrogen™ Human Aquaporin 6 (aa 237-280) Control Fragment Recombinant Protein

Product Code. 30200924

Brand: Invitrogen™ RP91071

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53296 (PA5-53296. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aquaporin 6 forms a water-specific channel that participates in distinct physiological functions such as glomerular filtration, tubular endocytosis and acid-base metabolism.

Specifications

• Accession Number: Q13520
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 363
• Name: Human Aquaporin 6 (aa 237-280) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI790337; AQP2L; Aqp6; AQP-6; aquaporin 2-like, kidney specific; aquaporin 6; aquaporin 6, kidney specific; Aquaporin-2-like; Aquaporin-6; aquaporin-6, kidney specific; hKID; KID; Kidney-specific aquaporin
• Common Name: Aquaporin 6
• Gene Symbol: AQP6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining