missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181463

Invitrogen™ Human Aquaporin 2 (aa 222-265) Control Fragment Recombinant Protein

Product Code. 30181463
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181463

Brand: Invitrogen™ RP99871

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111246 (PA5-111246. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aquaporin 2 (AQP2) is a hormonally regulated water channel located in the renal collecting duct. Mutations in the AQP2 gene cause hereditary nephrogenic diabetes insipidus in humans. A vasopressin induced cAMP increase results in the phosphorylation of AQP2 at serine-256 and its translocation from the intracellular vesicles to the apical membrane of principal cells. Recently, serine-261 has been identified as a novel phosphorylation site on AQP2 and levels of phosphorylated S261 have been shown to decrease with vasopressin treatment suggesting its involvement in vasopressin-dependent AQP2 trafficking.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P41181
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 359
Name Human Aquaporin 2 (aa 222-265) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ADH water channel; AQP 2; AQP CD; Aqp2; AQP-2; AQPCD; AQP-CD; aquaporin 2; aquaporin 2 (collecting duct); Aquaporin CD; Aquaporin2; aquaporin-2; Aquaporin-CD; Aquaporine 2; collecting duct water channel protein; cph; jpk; MGC34501; Water channel protein for renal collecting duct; water-channel aquaporin 2; WCH CD; WCHCD; WCH-CD
Common Name Aquaporin 2
Gene Symbol Aqp2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.