Invitrogen™ Human APS (aa 172-207) Control Fragment Recombinant Protein

Product Code. 30180672

Brand: Invitrogen™ RP99507

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62326 (PA5-62326. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

APS (adapter protein with Pleckstrin homology and Src homology 2 domains) a member of the Lnk family, is an adaptor protein that is involved in B-cell signaling, insulin signaling, cytoskeletal reorganization. It is tyrosine phosphorylated by JAK2, KIT and other kinases during B-cell receptor stimulation of many different cytokines, chemokines and leukokines. APS has been shown to inhibit the JAK-STAT pathway in collaboration with c-Cbl. It is located in the cytoplasm in pre-PDGF (platelet derived growth factor) stimulated cells and localizes to the plasma membrane and peripheral regions upon PDGF stimulation. This protein is expressed in B-cells and mast cells when detected in haematopoietic cell lines yet is also expressed in many different tissues including spleen, prostrate, testis, uterus, small intestine and skeletal muscle.

Specifications

• Accession Number: O14492
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10603
• Name: Human APS (aa 172-207) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: adapter protein with pleckstrin homology and Src homology 2 domains; adaptor protein with pleckstrin homology and src homology 2 domains; Alpha-1-antitrypsin; Aps; SH2 and PH domain-containing adapter protein APS; SH2B adapter protein 2; SH2B adaptor protein 2; Sh2b2
• Common Name: APS
• Gene Symbol: SH2B2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining