Invitrogen™ Human APOOL (aa 145-260) Control Fragment Recombinant Protein

Product Code. 30198347

Brand: Invitrogen™ RP91962

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51427 (PA5-51427. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein which contains an apolipoprotein O superfamily domain. This domain is found on proteins in circulating lipoprotein complexes. [provided by RefSeq, Sep 2011].

Specifications

• Accession Number: Q6UXV4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 139322
• Name: Human APOOL (aa 145-260) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6720473G16Rik; 9430083G14Rik; AAIR8193; apolipoprotein O like; apolipoprotein O-like; Apool; CXorf33; E130106L15Rik; FAM121A; family with sequence similarity 121 A; MIC27; MICOS complex subunit MIC27; Protein FAM121A; RGD1549725; UNQ8193; UNQ8193/PRO23204
• Common Name: APOOL
• Gene Symbol: APOOL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining