Invitrogen™ Human Apolipoprotein L4 (aa 210-292) Control Fragment Recombinant Protein

Product Code. 30197839

Brand: Invitrogen™ RP101146

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62049 (PA5-62049. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein.

Specifications

• Accession Number: Q9BPW4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80832
• Name: Human Apolipoprotein L4 (aa 210-292) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: APOL4; apolipoprotein L, 4; Apolipoprotein L4; apolipoprotein L-IV; APOLIV; APOL-IV; OTTHUMP00000028937
• Common Name: Apolipoprotein L4
• Gene Symbol: APOL4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TSTDQLEALRDILRDITPNVLSFALDFDEATKMIANDVHTLRRSKATVGRPLIAWRYVPINVVETLRTRGAPTRIVRKVARNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining