Invitrogen™ Human Apolipoprotein C1 (aa 28-77) Control Fragment Recombinant Protein

Product Code. 30204800

Brand: Invitrogen™ RP101269

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111339 (PA5-111339. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apolipoproteins are protein components of plasma lipoproteins. The apolipoprotein C gene family encodes four homologous proteins designated apoC-I to -IV, which specifically modulate the metabolism of triglyceride-rich lipoproteins. The human apoC-I gene maps to chromosome 19q13.2 and is expressed primarily in the liver where it is activated when monocytes differentiate into macrophages. The human apoC-II gene maps to chromosome 19q13.2 and encodes a 79 amino acid single chain protein that is a necessary cofactor for the activation of lipoprotein lipase, the enzyme that hydrolyzes triglycerides in plasma and transfers the fatty acids to tissues. The human apoC-III gene maps to chromosome 11q23 and encodes a protein that may delay catabolism of triglyceride-rich particles by inhibiting lipoprotein lipase and hepatic lipase. The human apoC-IV gene maps to chromosome 19q13.2 and encodes a 127 amino acid protein that is primarily expressed in the liver.

Specifications

• Accession Number: P02654
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 341
• Name: Human Apolipoprotein C1 (aa 28-77) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ALPCI; Apoc1; Apo-CI; ApoC-I; Apo-CIB; ApoC-IB; apolipoprotein C1; Apolipoprotein C-I; apolipoprotein C-I variant I; apolipoprotein C-I variant II; Liver regeneration-related protein LRRG04; LRRG04; Truncated apolipoprotein C-I
• Common Name: Apolipoprotein C1
• Gene Symbol: APOC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining