Invitrogen™ Human APOBEC3G (aa 227-375) Control Fragment Recombinant Protein

Product Code. 30210548

Brand: Invitrogen™ RP91476

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110643 (PA5-110643. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Apoliprotein B mRNA-editing, enzyme-catalytic, polypeptide-like (APOBEC) 3 is a multi-isoform member of the cytidine deaminase family of enzymes that act on monomeric nucleoside and nucleotide substrates. Similar to TRIM5-a which targets incoming retroviral capsids, APOBEC3 plays a major role in cellular defense against retroviral infection as at least two isoforms, APOBEC3G and to a lesser extent APOBEC3F, can be incorporated HIV-1 virions and induce hypermutation in the newly synthesized viral DNA and thus destabilize the viral genome. This innate mechanism of retroviral resistance is counteracted by the HIV-1 Vif protein by inducing the ubiquitization and degradation of APOBEC3G; a single amino acid substitution (D128K) blocks APOBEC3G depletion without affecting its inhibitory activity.

Specifications

• Accession Number: Q9HC16
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 60489
• Name: Human APOBEC3G (aa 227-375) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A3G; APOBEC3G; APOBEC-related cytidine deaminase; APOBEC-related protein; APOBEC-related protein 9; apolipoprotein B editing enzyme catalytic polypeptide-like 3 G; apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3 G; apolipoprotein B mRNA editing enzyme catalytic subunit 3 G; apolipoprotein B mRNA editing enzyme cytidine deaminase; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3 G; apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3 G; ARCD; ARP9; ARP-9; ASGPR2; ASGP-R2; bK150C2.7; CEM15; CEM-15; CLEC4H2; Deoxycytidine deaminase; dJ494G10.1; DNA dC->dU editing enzyme; DNA dC->dU-editing enzyme APOBEC-3 G; FLJ12740; HBXBP; HL-2; MDS019; OTTHUMP00000028911; phorbolin-like protein MDS019
• Common Name: APOBEC3G
• Gene Symbol: APOBEC3G
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining