Invitrogen™ Human APOBEC2 (aa 152-224) Control Fragment Recombinant Protein

Product Code. 30195809

Brand: Invitrogen™ RP90690

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82608 (PA5-82608. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.

Specifications

• Accession Number: Q9Y235
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10930
• Name: Human APOBEC2 (aa 152-224) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Apobec2; apolipoprotein B editing complex 2; apolipoprotein B mRNA editing enzyme catalytic polypeptide like 2; apolipoprotein B mRNA editing enzyme catalytic subunit 2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2; ARCD1; Arp1; C->U-editing enzyme APOBEC-2; mRNA(cytosine(6666)) deaminase 2; OTTHUMP00000039773; probable C->U-editing enzyme APOBEC-2
• Common Name: APOBEC2
• Gene Symbol: APOBEC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining