missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human APC6 (aa 539-620) Control Fragment Recombinant Protein

Product Code. 30203590
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203590

Brand: Invitrogen™ RP95122

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83633 (PA5-83633. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13042
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8881
Name Human APC6 (aa 539-620) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700071J12Rik; 2810431D22Rik; ANAPC6; Anaphase-promoting complex subunit 6; anaphase-promoting complex, subunit 6; APC6; Cdc16; CDC16 cell division cycle 16; CDC16 cell division cycle 16 homolog; CDC16 homolog; CDC16Hs; cell division cycle 16; cell division cycle 16 homolog; cell division cycle protein 16 homolog; CUT9; Cyclosome subunit 6; RP11-569D9.4
Common Name APC6
Gene Symbol Cdc16
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.