Invitrogen™ Human APC5 (aa 653-746) Control Fragment Recombinant Protein

Product Code. 30204714

Brand: Invitrogen™ RP104708

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83478 (PA5-83478. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a tetratricopeptide repeat-containing component of the anaphase promoting complex/cyclosome, a large E3 ubiquitin ligase that controls cell cycle progression by targeting a number of cell cycle regulators such as B-type cyclins for 26S proteasome-mediated degradation through ubiquitination. The encoded protein is required for the proper ubiquitination function of APC/C and for the interaction of APC/C with transcription coactivators. It also interacts with polyA binding protein and represses internal ribosome entry site-mediated translation. Multiple transcript variants encoding different isoforms have been found for this gene. These differences cause translation initiation at a downstream AUG and result in a shorter protein, compared to isoform a.

Specifications

• Accession Number: Q9UJX4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51433
• Name: Human APC5 (aa 653-746) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2510006G12Rik; AA408751; AA536819; AA986414; ANAPC5; anaphase promoting complex subunit 5; anaphase-promoting complex subunit 5; Anpc5; APC5; cyclosome subunit 5; MNCb-2778
• Common Name: APC5
• Gene Symbol: Anapc5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining