Invitrogen™ Human APC2 (aa 2221-2292) Control Fragment Recombinant Protein

Product Code. 30181365

Brand: Invitrogen™ RP98394

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67486 (PA5-67486. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cell cycle regulated protein ubiquitination and degradation within subcellular domains is thought to be essential for the normal progression of mitosis. APC2 is a highly conserved component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. APC/C is responsible for degrading anaphase inhibitors, mitotic cyclins, and spindle-associated proteins ensuring that events of mitosis take place in proper sequence. The individual APC/C components mRNA and protein levels are expressed at approximately the same levels in most tissues and cell lines, suggesting that they perform their functions as part of a complex. Like APC11, APC2 contains cullin and RING finger domains that are thought to be important in regulating ubiquitination activity.

Specifications

• Accession Number: O95996
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10297
• Name: Human APC2 (aa 2221-2292) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9230107K09Rik; adenomatosis polyposis coli 2; adenomatous polyposis coli like; adenomatous polyposis coli protein 2; Adenomatous polyposis coli protein-like; AI852447; AL024279; Anapc2; anaphase promoting complex subunit 2; anaphase-promoting complex subunit 2; APC2; APC2, WNT signaling pathway regulator; APCL; APC-like; Cyclosome subunit 2; EGK_07151; Emi4; expressed during mesenchymal induction 4; Imi4; induced during mesenchymal induction 4; KIAA1406; mKIAA1406; R75424
• Common Name: APC2
• Gene Symbol: APC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GQLSLLGSDVDGPSLAKAPISAPFVHEGLGVAVGGFPASRHGSPSRSARVPPFNYVPSPMVVAATTDSAAEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining