Invitrogen™ Human APBA1 (aa 145-222) Control Fragment Recombinant Protein

Product Code. 30211669

Brand: Invitrogen™ RP107049

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66374 (PA5-66374. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The munc-18 interacting protein (Mint) protein family is a group of evolutionarily conserved adaptor proteins that function in membrane transport and organization. In mammals, there exist three Mint isoforms, Mint1, 2, and 3. Although there is little amino acid sequence conservation in the amino-terminal half, the carboxy-terminal half of these proteins is highly conserved. Within this conserved portion there exists a phosphotyrosine-binding (PTB) and a PSD-95/DLG-A/ZO-1 (PDZ) domain, which function as protein interaction modules. Mint1 and 2 appear to be expressed exclusively in the brain and are found to bind to Munc18, an essential component of the synaptic vesicle fusion machinery. Mint3 is ubiquitously expressed in all tissues and is expressed at the lowest levels in the brain and testis. Studies show that mint3 does not interact with munc-18. Mint3 has been found to interact with the Alzheimer's Disease-related amyloid precursor protein (APP) and does so through its PTB and PDZ domains. It has been suggested that mint3 links APP to other transport machinery components, thereby regulating it transport, endocytosis, and metabolism. Abnormal APP metabolism has been shown to be the cause of an early-onset type of Alzheimer's disease.

Specifications

• Accession Number: Q02410
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 320
• Name: Human APBA1 (aa 145-222) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6430513E09Rik; adapter protein X11 alpha; adaptor protein X11 alpha; amyloid beta (A4) precursor protein binding, family A, member 1; amyloid beta (A4) precursor protein-binding family A APBA1: amyloid beta (A4) precursor protein-binding family A member 1 ( x 11); amyloid beta (A4) precursor protein-binding, family A, APBA1: amyloid beta (A4) precursor protein-binding, family A, member 1 ( x 11); amyloid beta (A4) precursor protein-binding, family A, member 1; amyloid beta (A4) precursor protein-binding, family A, member 1 ( x 11); amyloid beta A4 precursor protein-binding family A member 1; amyloid beta precursor protein binding family A member 1; Amyloid-beta A4 precursor protein-binding family A member 1; APBA1; D9S411E; LIN10; Lin-10; Mint; MINT1; Mint-1; neuronal Munc18-1-interacting protein 1; Neuron-specific X11 protein; phosphotyrosine-binding/-interacting domain (PTB)-bearing protein; Urop11; UROP11-110; X11; X11 A; X11 ALPHA
• Common Name: APBA1
• Gene Symbol: APBA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining