Invitrogen™ Human AP3S2 (aa 107-154) Control Fragment Recombinant Protein

Product Code. 30181371

Brand: Invitrogen™ RP99268

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61921 (PA5-61921. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AP3S2 (Adaptor Related Protein Complex 3 Subunit Sigma 2) is a Protein Coding gene. Among its related pathways are Lysosome. Gene Ontology (GO) annotations related to this gene include protein transporter activity. An important paralog of this gene is AP3S1. Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.

Specifications

• Accession Number: P59780
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10239
• Name: Human AP3S2 (aa 107-154) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: [s]3 B; adapter-related protein complex 3 sigma-2 subunit; adapter-related protein complex 3 subunit sigma-2; adaptor complex sigma3B; adaptor related protein complex 3 sigma 2 subunit; adaptor related protein complex 3, sigma 2 subunit; adaptor-related protein complex 3 subunit sigma-2; adaptor-related protein complex 3, sigma 2 subunit; adaptor-related protein complex AP-3, sigma 2 subunit; AP-3 complex sigma-3 B subunit; AP-3 complex subunit sigma-2; AP-3 complex subunit sigma-3 B; AP3S2; AP3S3; clathrin-associated/assembly/adaptor protein, small 4, 22-kD; FLJ35955; sigma 3 B; sigma3b; sigma-3 B-adaptin; sigma3B-adaptin; Sigma-adaptin 3 b
• Common Name: AP3S2
• Gene Symbol: AP3S2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining