Invitrogen™ Human AP2M1 (aa 357-435) Control Fragment Recombinant Protein

Product Code. 30206403

Brand: Invitrogen™ RP96388

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The heterotetrameric coat assembly protein complex, also known as the adaptor-related protein complex 2 (AP-2), belongs to the adaptor complexes medium subunits family. The mu 1 subunit of the AP-2 complex (AP2M1) is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. AP2M1 has also been shown to associate with the HIV-1 protein Nef, suggesting that Nef may use AP-2 complex to enhance the rate of endocytosis of both CD4 and class I MHC. AP2M1 may also play an important role in regulating the intracellular trafficking and function of cytotoxic T-lymphocyte associated (CTLA)-4 protein. At least two isoforms of AP2M1 are known to exist.

Specifications

• Accession Number: Q96CW1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1173
• Name: Human AP2M1 (aa 357-435) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: adapter-related protein complex 2 mu subunit; adapter-related protein complex 2 subunit mu; adaptin-mu2; Adaptor protein complex AP-2 subunit mu; adaptor related protein complex 2 mu 1 subunit; adaptor related protein complex 2 subunit mu 1; adaptor related protein complex 2, mu 1 subunit; adaptor-related protein complex 2 subunit mu; adaptor-related protein complex 2, mu 1 subunit; AP-2 complex subunit mu; AP-2 mu 2 chain; AP-2 mu chain; Ap2m1; AP50; Clapm1; clathrin adaptor complex AP2, mu subunit; Clathrin assembly protein complex 2 medium chain; clathrin assembly protein complex 2 mu medium chain; clathrin coat adaptor protein AP50; Clathrin coat assembly protein AP50; Clathrin coat-associated protein AP50; clathrin-associated/assembly/adaptor protein, medium 1; coat assembly protein complex 50 kD; HA2 50 kDA subunit; KIAA0109; mu2; Mu2-adaptin; Plasma membrane adaptor AP-2 50 kDa protein; plasma membrane adaptor AP-2 50 kDA protein; QtsA-16673; unnamed protein product
• Common Name: AP2M1
• Gene Symbol: AP2M1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining